Recombinant Human C-type lectin domain family 4 member C (CLEC4C), partial (Active)

In Stock
Code CSB-EP855470HU
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Measured by its binding ability in a functional ELISA. Immobilized CLEC4C protein at 1 μg/ml can bind human CLEC4C antibody, the EC50 of human CLEC4C antibody is 31.43-43.52 μg/ml.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP855470HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) CLEC4C.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP855470HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) CLEC4C.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Measured by its binding ability in a functional ELISA. Immobilized CLEC4C protein at 1 μg/ml can bind human CLEC4C antibody, the EC50 of human CLEC4C antibody is 31.43-43.52 μg/ml.
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
CLEC4C; BDCA2; CLECSF11; CLECSF7; DLEC; HECL; UNQ9361/PRO34150C-type lectin domain family 4 member C; Blood dendritic cell antigen 2; BDCA-2; C-type lectin superfamily member 7; Dendritic lectin; CD antigen CD303
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
45-213aa
Target Protein Sequence
NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI
Mol. Weight
36.0 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Explore the possibilities of our high-quality Recombinant Human CLEC4C protein, also known as C-type lectin domain family 4 member C or CD303, for your immunology research applications. Derived from E.coli, this extracellular domain protein (45-213aa) features an N-terminal 6xHis-SUMO tag, facilitating efficient detection and purification. With a purity of >90% as determined by SDS-PAGE, this protein ensures reliable performance in your experiments. The biological activity of Recombinant Human CLEC4C is demonstrated by its binding ability in a functional ELISA, with an EC50 of 31.43-43.52 μg/ml for immobilized CLEC4C binding to the human CLEC4C antibody. Provided as a lyophilized powder, our Recombinant Human CLEC4C protein empowers you to advance your immunology research with consistent results and precision scientific quality.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Lectin-type cell surface receptor which may play a role in antigen capturing by dendritic cells. Specifically recognizes non-sialylated galactose-terminated biantennary glycans containing the trisaccharide epitope Gal(beta1-3/4)GlcNAc(beta1-2)Man. Binds to serum IgG. Efficiently targets ligand into antigen-processing and peptide-loading compartments for presentation to T-cells. May mediate potent inhibition of induction of IFN-alpha/beta expression in plasmacytoid dendritic cells. May act as a signaling receptor that activates protein-tyrosine kinases and mobilizes intracellular calcium.
Gene References into Functions
  1. Identification of serum glycoprotein ligands for the immunomodulatory receptor blood dendritic cell antigen 2. PMID: 29796630
  2. decrease in the surface expression of CLEC4C and the endoplasmic reticulum localization of the mutant construct were observed PMID: 26943047
  3. Human BDCA2+CD123+CD56+ dendritic cells (DCs) related to blastic plasmacytoid dendritic cell neoplasm represent a unique myeloid DC subset. PMID: 25779340
  4. BDCA-2 binds selectively to glycans containing the epitope Galbeta1-3/4GlcNAcbeta1-2Man. PMID: 25995448
  5. We show the crystal structures of a carbohydrate recognition domain (CRD) of human C-type lectin receptor blood dendritic cell antigen-2 (BDCA2). PMID: 24425442
  6. Reduction in Treg numbers following Ag delivery to BDCA2 restored both CD4(+) T cell activation and Ab responses, demonstrating that Tregs were required for the observed tolerance. PMID: 24829416
  7. Data show that HCV envelope glycoprotein E2 is a novel ligand of blood dendritic cells antigen 2 (BDCA-2). PMID: 23053572
  8. Human C-type lectin domain family 4, member C (CLEC4C/BDCA-2/CD303) is a receptor for asialo-galactosyl-oligosaccharides. PMID: 21880719
  9. Accumulation of BDCA-1 and BDCA-2 around neovessels showed that mDCs and pDCs are recruited to advanced arteriosclerotic plaques. PMID: 21436634
  10. Expression of dendritic cell markers CD11c/BDCA-1 and CD123/BDCA-2 in coronary artery disease upon activation in whole blood. PMID: 20888334
  11. Indoleamine 2,3-deoxigenase positive plasmacytoid dentritic cells are the classical BDCA2 positive cells in melanoma lymph nodes PMID: 19829303
  12. Data suggest that by associating with Fc epsilon RI gamma, BDCA2 activates a novel BCR-like signaling pathway to regulate the immune functions of plasmacytoid dendritic cells. PMID: 17850179
  13. Triggering CD303 leads to tyrosine phosphorylation of Syk, Slp65, PLCgamma2 and cytoskeletal proteins. CD303 signaling is linked with internalization by clathrin-mediated endocytosis. PMID: 18022864
  14. results suggest that downregulation of BDCA2 expression on plasmacytoid dendritic cells (pDCs) may reflect the activation of pDCs accumulated in systemic lupus erythematosus patients & may be one marker for indication of disease activity of SLE patients PMID: 18684674
  15. Engagement of BDCA-2 blocks TRAIL-mediated cytotoxic activity of plasmacytoid dendritic cells. PMID: 19577819

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type II membrane protein.
Tissue Specificity
Expressed in plasmacytoid dendritic cells (PDCs). Constitutively expressed in immature monocyte-derived dendritic cells (iMDDC) and is significantly down-regulated upon maturation with LPS but not with TNF-alpha.
Database Links

HGNC: 13258

OMIM: 606677

KEGG: hsa:170482

STRING: 9606.ENSP00000353500

UniGene: Hs.351812

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*